ATPAF1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATP synthase mitochondrial F1 complex assembly factor 1

Protein Size: 328

Purification: Affinity Purified

• Artikelnummer: AVIARP57652_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57652_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64756
• Wirt: Rabbit