ATXN7L1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of ATXN7L1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATXN7L1

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ataxin 7-like 4, isoform CRA_a EMBL EAW83370.1

Protein Size: 146

Purification: Affinity Purified

• Artikelnummer: AVIARP55521_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55521_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 222255
• Wirt: Rabbit