B2M Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M

Key Reference: Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beta-2-microglobulin

Protein Size: 119

Purification: Affinity Purified

• Artikelnummer: AVIARP56555_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56555_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 567
• Wirt: Rabbit