Bax Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Bax is a bcl2-related gene and is involved in the regulation of apoptotic cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Bax

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apoptosis regulator BAX Ensembl ENSRNOP00000028328

Protein Size: 192

Purification: Affinity Purified

• Artikelnummer: AVIARP58871_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58871_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 24887
• Wirt: Rabbit