Bloc1s2 Antibody - N-terminal region : FITC

Bloc1s2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55703_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Bloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking.

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 2

Protein Size: 143

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP55703_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55703_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 73689
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×