C10orf56 Antibody - middle region : HRP

C10orf56 Antibody - middle region : HRP
Artikelnummer
AVIARP55587_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C10orf56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf56

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger CCHC domain-containing protein 24

Protein Size: 241

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55587_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55587_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219654
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×