C10orf96 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf96

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 172

Protein Size: 258

Purification: Affinity Purified

• Artikelnummer: AVIARP55892_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55892_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 374355
• Wirt: Rabbit