English
C12orf40 Antibody - N-terminal region : FITC
C12orf40 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54472_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The exact function of C12orf40 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 74kDa
Peptide Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Uncharacterized protein C12orf40
Protein Size: 652
Purification: Affinity Purified
Description of Target: The exact function of C12orf40 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 74kDa
Peptide Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Uncharacterized protein C12orf40
Protein Size: 652
Purification: Affinity Purified
| Artikelnummer | AVIARP54472_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54472_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Pig (Porcine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 283461 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
