C14orf177 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C14orf177 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf177

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein C14orf177

Protein Size: 125

Purification: Affinity Purified

• Artikelnummer: AVIARP55821_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55821_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283598
• Wirt: Rabbit