C17orf71 Antibody - middle region : FITC

C17orf71 Antibody - middle region : FITC
Artikelnummer
AVIARP57129_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C17orf71

Key Reference: 0

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SMG8

Protein Size: 991

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57129_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57129_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55181
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×