C17orf97 Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC

Molecular Weight: 50 kDa

Peptide Sequence: Synthetic peptide located within the following region: GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf97

Protein Size: 453

Purification: Affinity Purified

• Artikelnummer: AVIARP54432_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54432_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Human Gene ID: 400566
• Wirt: Rabbit