C17orf97 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of LOC400566 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC400566

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf97

Protein Size: 433

Purification: Affinity Purified

• Artikelnummer: AVIARP54431_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54431_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 400566
• Wirt: Rabbit