C18orf10 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of C18orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin polyglutamylase complex subunit 2

Protein Size: 300

Purification: Affinity Purified

Subunit: 2

• Artikelnummer: AVIARP55266_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55266_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25941
• Wirt: Rabbit