C18orf10 Antibody - middle region : FITC

C18orf10 Antibody - middle region : FITC
Artikelnummer
AVIARP55266_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C18orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin polyglutamylase complex subunit 2

Protein Size: 300

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP55266_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55266_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25941
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×