C18orf10 Antibody - middle region : HRP

C18orf10 Antibody - middle region : HRP
Artikelnummer
AVIARP55267_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of C18orf10 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin polyglutamylase complex subunit 2

Protein Size: 300

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP55267_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55267_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25941
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×