C18orf32 Antibody - middle region : Biotin

C18orf32 Antibody - middle region : Biotin
Artikelnummer
AVIARP56250_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf32

Key Reference: Matsuda,A., (2003) Oncogene 22 (21), 3307-3318

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0729 protein C18orf32

Protein Size: 76

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56250_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56250_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 497661
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×