C18orf32 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C18orf32

Key Reference: Matsuda,A., (2003) Oncogene 22 (21), 3307-3318

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0729 protein C18orf32

Protein Size: 76

Purification: Affinity Purified

• Artikelnummer: AVIARP56250_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56250_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 497661
• Wirt: Rabbit