C22orf28 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf28

Key Reference: Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA-splicing ligase RtcB homolog

Protein Size: 505

Purification: Affinity Purified

• Artikelnummer: AVIARP56746_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56746_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51493
• Wirt: Rabbit