C2orf25 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of C2orf25 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf25

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonic aciduria and homocystinuria type D protein, mitochondrial

Protein Size: 296

Purification: Affinity Purified

• Artikelnummer: AVIARP55332_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55332_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27249
• Wirt: Rabbit