C2orf55 Antibody - middle region : FITC

C2orf55 Antibody - middle region : FITC
Artikelnummer
AVIARP56003_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf55

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA1211-like

Protein Size: 962

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56003_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56003_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 343990
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×