C2orf68 Antibody - N-terminal region : HRP

C2orf68 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54429_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC388969 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC388969

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0561 protein C2orf68

Protein Size: 166

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54429_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54429_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 388969
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×