C5orf36 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of C5orf36 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf36

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA0825

Protein Size: 324

Purification: Affinity Purified

• Artikelnummer: AVIARP55682_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55682_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 285600
• Wirt: Rabbit