English
C6orf199 Antibody - N-terminal region : FITC
C6orf199 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55456_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The function of the C6orf199 protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf199
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 48kDa
Peptide Sequence: Synthetic peptide located within the following region: TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Adenylate kinase domain-containing protein 1
Protein Size: 421
Purification: Affinity Purified
Description of Target: The function of the C6orf199 protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf199
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 48kDa
Peptide Sequence: Synthetic peptide located within the following region: TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Adenylate kinase domain-containing protein 1
Protein Size: 421
Purification: Affinity Purified
| Artikelnummer | AVIARP55456_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55456_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 221264 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
