English
C9orf25 Antibody - middle region : Biotin
C9orf25 Antibody - middle region : Biotin
Artikelnummer
AVIARP55478_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The function of this protein has not been determined.The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf25
Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Protein FAM219A
Protein Size: 168
Purification: Affinity Purified
Description of Target: The function of this protein has not been determined.The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf25
Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Protein FAM219A
Protein Size: 168
Purification: Affinity Purified
| Artikelnummer | AVIARP55478_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55478_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 203259 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
