C9orf43 Antibody - middle region : FITC

C9orf43 Antibody - middle region : FITC
Artikelnummer
AVIARP55555_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the C9orf43 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf43

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C9orf43

Protein Size: 461

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55555_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55555_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 257169
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×