CALR Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALR

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calreticulin

Protein Size: 417

Purification: Affinity Purified

• Artikelnummer: AVIARP58123_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58123_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 811
• Wirt: Rabbit