CALR3 Antibody - N-terminal region : HRP

CALR3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58601_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-4 BC014595.2 1-4 5-443 DB459545.1 7-445 444-528 BP370084.1 424-508 529-1034 BC014595.2 529-1034 1035-1035 AC008764.9 27895-27895 c 1036-1273 BC014595.2 1036-1273 1274-1285 DB510196.1 313-324

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALR3

Key Reference: Hayashi,E., (2007) Clin. Cancer Res. 13 (21), 6267-6274

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calreticulin-3

Protein Size: 384

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58601_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58601_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 125972
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×