CAMK1G Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMK1G

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1G

Protein Size: 476

Purification: Affinity Purified

• Artikelnummer: AVIARP57417_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57417_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57172
• Wirt: Rabbit