CAMK1G Antibody - N-terminal region : HRP

CAMK1G Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57417_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMK1G

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1G

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57417_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57417_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57172
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×