CASS4 Antibody - N-terminal region : Biotin

CASS4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57390_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CASS4 is a docking protein that plays a role in tyrosine kinase-based signaling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cas scaffolding protein family member 4

Protein Size: 349

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57390_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57390_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57091
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×