CATIP Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf62

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ciliogenesis-associated TTC17-interacting protein

Protein Size: 387

Purification: Affinity Purified

• Artikelnummer: AVIARP55902_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55902_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 375307
• Wirt: Rabbit