CATIP Antibody - N-terminal region : FITC

CATIP Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55901_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf62

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ciliogenesis-associated TTC17-interacting protein

Protein Size: 389

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55901_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55901_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 375307
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×