CATSPERE Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CA101

Key Reference: N/A

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: CFLWYYRVRHFFNNFTQLITVWAYDPESADPDELLGNAEEPSINSIVLST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cation channel sperm-associated protein subunit epsilon

Protein Size: 832

Purification: Affinity purified

• Artikelnummer: AVIARP55699_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55699_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 257044
• Wirt: Rabbit