CCDC184 Antibody - middle region : HRP

CCDC184 Antibody - middle region : HRP
Artikelnummer
AVIARP54427_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC387856

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: coiled-coil domain-containing protein 184

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54427_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54427_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 387856
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×