English
CCDC187 Antibody - N-terminal region : FITC
CCDC187 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55951_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50722
Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Molecular Weight: 103kDa
Peptide Sequence: Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: coiled-coil domain-containing protein 187
Protein Size: 953
Purification: Affinity Purified
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50722
Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Molecular Weight: 103kDa
Peptide Sequence: Synthetic peptide located within the following region: DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: coiled-coil domain-containing protein 187
Protein Size: 953
Purification: Affinity Purified
| Artikelnummer | AVIARP55951_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55951_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 399693 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
