CCDC28A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC28A

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 28A

Protein Size: 274

Purification: Affinity Purified

• Artikelnummer: AVIARP55253_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55253_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25901
• Wirt: Rabbit