CCDC69 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of CCDC69 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 69

Protein Size: 296

Purification: Affinity Purified

• Artikelnummer: AVIARP55307_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55307_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26112
• Wirt: Rabbit