English
Ccnb1ip1 Antibody - N-terminal region : Biotin
Ccnb1ip1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58439_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ccnb1ip1
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: MCG50291 EMBL EDL20823.1
Protein Size: 276
Purification: Affinity Purified
Description of Target: The function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ccnb1ip1
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: MCG50291 EMBL EDL20823.1
Protein Size: 276
Purification: Affinity Purified
| Artikelnummer | AVIARP58439_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58439_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 239083 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
