CCR2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR2

Key Reference: Hendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: C-C chemokine receptor type 2

Protein Size: 374

Purification: Affinity Purified

• Artikelnummer: AVIARP58409_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58409_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1231
• Wirt: Rabbit