CDCA5 Antibody - middle region : Biotin

CDCA5 Antibody - middle region : Biotin
Artikelnummer
AVIARP58264_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Key Reference: Schmitz,J., (2007) Curr. Biol. 17 (7), 630-636

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sororin

Protein Size: 252

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58264_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58264_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 113130
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×