CDRT4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of CDRT4 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDRT4

Key Reference: Inoue,K., (2001) Genome Res. 11 (6), 1018-1033

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CMT1A duplicated region transcript 4 protein

Protein Size: 151

Purification: Affinity Purified

• Artikelnummer: AVIARP55668_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55668_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 284040
• Wirt: Rabbit