CELA2A Antibody - C-terminal region : HRP

CELA2A Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57698_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEL2A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: CNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: chymotrypsin-like elastase family member 2A

Protein Size: 269

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57698_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57698_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63036
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×