CENPQ Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ

Key Reference: 0

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein Q

Protein Size: 268

Purification: Affinity Purified

• Artikelnummer: AVIARP57121_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57121_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55166
• Wirt: Rabbit