English
CFAP299 Antibody - N-terminal region : HRP
CFAP299 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55538_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C4orf22
Key Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: cilia- and flagella-associated protein 299; uncharacterized protein C4orf22
Protein Size: 233
Purification: Affinity Purified
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C4orf22
Key Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693
Molecular Weight: 27kDa
Peptide Sequence: Synthetic peptide located within the following region: YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: cilia- and flagella-associated protein 299; uncharacterized protein C4orf22
Protein Size: 233
Purification: Affinity Purified
| Artikelnummer | AVIARP55538_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55538_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 255119 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
