English
CFAP53 Antibody - N-terminal region : FITC
CFAP53 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55454_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cilia- and flagella-associated protein 53
Protein Size: 514
Purification: Affinity Purified
Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cilia- and flagella-associated protein 53
Protein Size: 514
Purification: Affinity Purified
| Artikelnummer | AVIARP55454_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55454_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 220136 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
