CFHR2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFHR2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Complement factor H-related protein 2

Protein Size: 243

Purification: Affinity Purified

• Artikelnummer: AVIARP54784_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54784_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3080
• Wirt: Rabbit