CHMP1B Antibody - N-terminal region : HRP

CHMP1B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57408_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Charged multivesicular body protein 1b

Protein Size: 199

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57408_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57408_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57132
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×