Chmp2b Antibody - N-terminal region : FITC

Chmp2b Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54967_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Chmp2b

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 213

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54967_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54967_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 363720
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×