CHORDC1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHORDC1

Key Reference: Shirasu,K., (1999) Cell 99 (4), 355-366

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity Purified

• Artikelnummer: AVIARP54844_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54844_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26973
• Wirt: Rabbit