CLUAP1 Antibody - C-terminal region : FITC

CLUAP1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55150_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CLUAP1 may play a role in cell proliferation or apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLUAP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Clusterin-associated protein 1

Protein Size: 413

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55150_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55150_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23059
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×